Procurar Leuprolide De Abastecimento De Laboratório, Pó Esteróide, Peptide Lecirelin Leuprolide no diretório Industry Directory, fabricante / fornecedor / Fábrica confiável a partir de China

Cesta de Consulta (0)
Página inicial > Lista de Produto > Peptides da pureza alta > 98% Pureza Mod Grf (1-29) com ODM

98% Pureza Mod Grf (1-29) com ODM

Informação básica

Modelo:  API

Descrição do produto

N ° de Modelo: API Customized: Customized Adequado para: Adult Pureza:> 98% Aspecto: Pó Armazenamento: -18 Marca: Filtro Especificação: iu, mg, g Código HS: 3002200000 Pó: Sim Certificação: GMP Estado: Pó Cor: Branco Marca: Filtro CAS: 863288-34-0 Pacote de Transporte: Engarrafado Origem: Shanghai CJC-1295 sem DAC (CJC-1293) \ nCJC-1295 sem DAC (CJC-1293), um peptídeo de 29 aminoácidos com sequência Y (dA ) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, é um análogo peptídico tetrassubstituído de GHRH com substituições D-Ala, Gln, Ala e Leu nas posições 2, 8, 15 e 27, respectivamente, o que pode tornar o péptido mais estável. Uma de suas vantagens em relação ao GHRH tradicional é sua capacidade de se bioconjugar com a albumina sérica, aumentando assim sua meia-vida e janela terapêutica. Isso é feito usando grupos de proteção em torno dos aminoácidos do GHRH normalmente suscetíveis à degradação enzimática.
Product Name CJC-1295 without DAC(CJC-1293)
Place of origin China
Routine use of storage 2-8ºC
Cycle-time 3-7days
Purity 98%min
Brand Name Filter
Valid Date 2years
Delivery Date In 7 days
\ n Lista de produtos:
NO. Name Purity CAS
1 Abarelix Acetate 98% 183552-38-7
2 Alarelin Acetate 98% 79561-22-1
3 Angiotensin Acetate 98% 58-49-1
4 Angiotensin II 98%  68521-88-0
5 Antide Acetate 98% 112568-12-4
6 Argpressin Acetate 98% 113-79-1
7 Argreline Acetate 98%  616204-22-9
8 Atosiban Acetate 98% 90779-69-4
9 Aviptadil Acetate 98% 40077-57-4
10 Bate-Amyloid(1-42)human 95% 107761-42-2
11 Bivalirudin Trifluoroacetate 98% 128270-60-0
12 Buserelin acetate 98% 57982-77-1
13 Calcuitonin   9007/12/9
14 Carbetocin Acetate 98% 37025-55-1
15 Carperitide 98%  89213-87-6
16 Cerropin B 98%  
17 Cetrorelix Acetate 98% 130143-01-0
18 Cetrorelix Acetate 98% 130143-01-0
19 CJC-1295 98%  863288-34-0
20 Copper Peptide(GHK-Cu) 98% 49557-75-7
21 CRF (human, rat) Acetate 98% 86784-80-7
22 CRF (ovine) Trifluoroacetate 98% 79804-71-0
23 Deslorelin Acetate 98% 57773-65-6
24 Desmopressin Acetate   98% 16679-58-6
25 Dynorphin A (1-13) Acetate   98% 72957-38-1
26 Elcatonin Acetate 98% 60731-46-6
27 Eledoisin Acetate 98% 69-25-0
28 Endothelin-1 Acetate 98% 117399-94-7
29 Enfuvirtide Acetate (T-20) 95% 159519-65-0
30 Eptifibatide Acetate 98% 148031-34-9/188627-80-7
31 Exenatide Acetate 98% 141732-76-5
32 Felypressin Acetate 98% 56-59-7
33 Fertirelin Acetate 98% 38234-21-8
34 Ganirelix acetate 98% 123246-29-7
35 GHRP-2 Acetate 98% 158861-67-7
36 GHRP-6 Acetate 98% 87616-84-0
37 Glatiramer Acetate 99% 147245-92-9
38 GLP(7-36) 98% 107444-51-9
39 GLP-1 (7-37) Acetate 98% 106612-94-6
40 Glucagon Hydrochloride 98% 16941-32-5
41 Gonadorelin Acetate 98% 34973-08-5
42 Goserelin Acetate 98% 145781-92-6
43 GRF (human) Acetate 98% 83930-13-6
44 Hexarelin Acetate 98% 140703-51-1
45 Histrelin Acetate 98% 76712-82-8
46 Icatibant Acetate 98% 30308-48-4
47 Lanreotide 98%  108736-35-2 
48 Lecirelin (Dalmarelin)  Acetate     98% 61012-19-9
49 Leuprolide 98%  74381-53-6
50 Leuprorelin Acetate 98% 53714-56-0
51 Linaclotide Acatate 98% 851199-59-2
52 Lixisenatide 98% 320367-13-3
53 Lraglutide 98% 204656-20-2
54 Lysipressin Acetate 98% 50-57-7
55 Melanotan II Acetate 98% 121062-08-6
56 MOG(35-55) 98% 163913-87-9 
57 Nafarelin Acetate 98% 76932-56-4
58 Nesiritide Acetate (BNP-32) 98% 114471-18-0
59 Octreotide 98% 79517-01-4
60 Ornipressin Acetate 98% 3397-23-7
61 Oxytocin Acetate 98% 50-56-6
62 Palmitoyl Pentapeptide 98% 214047-00-4
63 Pexiganan 98% 147664-63-9
64 Pramlintide Acetate 98% 196078-30-5
65 Pretirelin    
66 PT141 Acetate 98% 32780-32-8
67 Salmon Calcitonin Acetate 98% 47931-85-1
68 Secretin Acetate 98% 10813-74-8
69 Sermorelin Aceta 98% 86168-78-7
70 Sincalide 98% 25126-32-3
71 Somatostatin Acetate 98% 38916-34-6
72 Splenopentin Acetate 98% 105184-37-0
73 Taltirelin Acetate 98% 103300-74-9
74 Teriparatide Acetate 98% 52232-67-4
75 Teriparatide Acetate 98% 52232-67-4
76 Terlipressin Acetate   98% 14636-12-5
77 Tetracosactide Acetate 98% 16960-16-0
78 Thymalfasin 98% 62304-98-7 
79 Thymopentin 98% 69558-55-0
80 Thymosin α1 Acetate 98% 14636-12-5
81 Thymosin β4 Acetate 98% 77591-33-4
82 Triptorelin Acetate 98% 57773-63-4
83 Vapreotide Acetate 98% 103222-11-3
84 Vasopressin Acetate 98% 9034-50-8
85 Ziconotide Acetate 98% 107452-89-1
\ n \ n \ n \ n \ n \ n

Grupo de Produto : Peptides da pureza alta

Enviar e-mail para este fornecedor
  • *Assunto:
  • a:

  • *Mensagens:
    Sua mensagem deve estar entre 20-8000 caracteres