Procurar 7-37-Glucagon-like Peptid Human 106612-94-6, High Purity Human GLP-1 7-37 CAS 106612-94-6, Matérias-primas Farmacêuticas GLP-1 Acetato no diretório Industry Directory, fabricante / fornecedor / Fábrica confiável a partir de China

Cesta de Consulta (0)
Página inicial > Lista de Produto > Peptides da pureza alta > Pureza 98% de péptido hormonal de crescimento humano GLP-1 CAS 106612-94-6

Pureza 98% de péptido hormonal de crescimento humano GLP-1 CAS 106612-94-6

Pureza 98% de péptido hormonal de crescimento humano GLP-1 CAS 106612-94-6

    Tipo de pagamento: T/T
    Terms of Trade: CIF
    Quantidade de pedido mínimo: 1 Kilogram
    Tempo de entrega: 15 dias
    Pacote: COMO REQUERIDO
    produtividade: KGS
    marca: VOLSENCHEM
    transporte: Air
    Lugar de origem: CHINA
    Habilidade da fonte: TRUE MANUFACTURER
    Certificados : GMP Peptide

Informação básica

Modelo: 106612-94-6

Descrição do produto

Oferecemos excelente qualidade e alta pureza GLP-1 CAS 106612-94-6. Glucagon como o péptido -1 (GLP-1) é uma secreção de péptidos intestinais secreção de células endócrinas ileais, atualmente principalmente como alvo para a ação de drogas de diabetes tipo 2. A vantagem do GLP-1 CAS 106612-94-6 pode reduzir a inibição do esvaziamento gástrico, peristaltismo intestinal. Isso fornece uma perspectiva muito boa para o tratamento de diabetes mellitus tipo 2. Mas porque o GLP-1 é um polipéptido, não pode ser administrado por via oral é uma deficiência importante. Somos habilidosos para produzir GLP-1 de alta pureza. Nós podemos fornecer embalagens diferentes para atender aos requisitos dos clientes.


Thera. Egory Cat: Pharmaceutical Peptide

CAS:. 106612-94-6

Sinônimos: proglucagon (78-108) (humana, bovina, cobaia, rato); Preproglucagom 78-108 HUMANO; Preproglucagon (98-128) (humana, bovina, cobaia, murganho, rato); Insulinotropina (humana, bovina, cobaia, murganho, rato); HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP- LEU-VAL-LYS-GLY-ARG-GLY; H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA- TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; GLP-1 (HUMANO, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG)

106612-94-6

Fórmula molecular: C151H228N40O47

Peso Molecular: 3.355,67

Pureza: ≥98%

Embalagem: Exportação de embalagem digna

Material Safety Data Sheet: Disponível a pedido

Uso: usado como hormônio paracrino envolvido na inibição do glucagon

Taizhou Volsen Chemical Co., Ltd.

 

Taizhou Volsen Chemical Co., Ltd. é profissional em P&D, produzindo e comercializando matérias-primas farmacêuticas , intermediários farmacêuticos na China. A VOLSEN consiste em cerca de 100 funcionários experientes, incluindo 3 doutores e 10 mestres, e instalações de 35.000 metros quadrados, incluindo laboratórios de pesquisa, laboratório de quilo, planta piloto e planta de fabricação completa,


Os especialistas em pesquisa e desenvolvimento da VOLSEN, gerente de qualidade e vendas com muita experiência garantem que os produtos sejam confiáveis ​​e o serviço seja profissional. A pessoa produtora inspeciona todas as etapas de todo o processo e verifica rigorosamente a qualidade, a fim de garantir que cada lote de matéria-prima atinja o padrão de EP, CP, JP, BP etc. Correspondendo aos requisitos diversificados das empresas VOLSEN está marchando para alcançar os picos.


A Volsen possui um departamento profissional de síntese personalizado, com mais de 15 pesquisas científicas sênior pessoal químico com pós-graduação ou superior . Temos também um sistema de gestão científica independente. Nossa empresa integra es anos de experiências de produção e reservas de talentos que formam uma forte capacidade de produção de P&D , além disso, poderíamos realizar várias personalizações de produtos químicos de kg a tonelada, dependendo da base de produção e equipamentos existentes.


A Unidade de Manufatura está equipada com uma instalação de reeducação progressiva de emissões, efluentes e descarga de resíduos que são conhecidos por causar um impacto negativo no meio ambiente. Além disso, o laboratório e a fábrica estão equipados com as mais recentes máquinas, equipamentos, pessoal técnico e meios de comunicação.

Devido ao fornecimento de qualidade confiável , acompanhamento eficiente, entrega programada e resposta imediata a qualquer assunto, a empresa recebe bons comentários dos clientes.

Nosso objetivo era oferecer valor comercial real aos nossos clientes. Para qualquer interesse, pls ligue para nós ou envie um email para obter nossos melhores serviços.

Informação de Companhia

  • Nome da empresa: Taizhou Volsen Chemical Co., Ltd.
  • representante: Mr Chen
  • Produto / Serviço: Favipiravir Intermediários , Intermediários de Arbidol , Relugolix Intermediates , Vilanterol Intermediários , Remdesivir Intermediários , Brometo de Umeclidinium
  • capital: 60000000RMB
  • Ano de Fundação: 2002
  • Volume anual de vendas (milhões EUA $): Above US$100 Million
  • Porcentagem de exportação: 91% - 100%
  • Volume de Compra Anual Total (EUA $ Milhões): Below US$1 Million
  • N º de Linhas de Produção: 5
  • Número de Funcionários de I&D: 91 -100 People
  • Número de Funcionários QC: 11 -20 People
  • Serviços OEM Desde: yes
  • Tamanho da Fábrica (metros Quadrados): 30,000-50,000 square meters
  • Localização da Fábrica: Dongying Economic Development Zone , Dongying, Shandong,China
  • Pessoa De Contato: Ms. Amy Cheng
  • Número De Telefone: 86-576-88869393
Enviar e-mail para este fornecedor
  • *Assunto:
  • a:

  • *Mensagens:
    Sua mensagem deve estar entre 20-8000 caracteres